PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20256
Common NameKK1_020857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 473aa    MW: 53238.3 Da    PI: 6.5189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20256genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.4e-142367348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
    C.cajan_20256 23 TWSQEEDDILREQIGIHGTENWAVIASKFK-DKTTRQCRRRWYTYL 67
                     6****************************9.*************97 PP

2Myb_DNA-binding42.61.4e-1373116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
    C.cajan_20256  73 KGGWSAEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 116
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3741667IPR017930Myb domain
SMARTSM007173.1E-132069IPR001005SANT/Myb domain
SuperFamilySSF466893.79E-2520114IPR009057Homeodomain-like
CDDcd001671.22E-122367No hitNo description
PfamPF139215.7E-142484No hitNo description
Gene3DG3DSA:1.10.10.604.1E-202475IPR009057Homeodomain-like
PROSITE profilePS5129419.4868122IPR017930Myb domain
SMARTSM007172.7E-1472120IPR001005SANT/Myb domain
CDDcd001672.82E-1076117No hitNo description
Gene3DG3DSA:1.10.10.604.6E-1876121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MQDMKQKQQG NEESKKKERH IVTWSQEEDD ILREQIGIHG TENWAVIASK FKDKTTRQCR  60
RRWYTYLNSD FKKGGWSAEE DMLLCEAQKI FGNRWTEIAK VVSGRTDNAV KNRFSTLCRK  120
REKYAALAKE NCTSYINSNN KRIILQHYNN MDTTSESGVP IGKMRRAHIP DDAEKIKFGD  180
RSHLQNRTQI NQQPRAPFAV LAQNSNNLNN LPGQDHACNP KFNSSAQNNK SQGTFLKTDD  240
PKRSALMQQA ELLSSLALKV DTENMDQSLE NAWKALQEFL NRTKESDIPG HKIRDLQLKD  300
VEDMIEDLMN GSENGQACWR QVERHEDSPG SSGYSTGSTL LCQSAGDNLD HSLHEDIGTE  360
IKSEQFGDEK GVGRDEKGVL STANVDQDLF PSCEEQINND GIVSALSGSE EFSSPLQVTP  420
LFRSLAAGIP SPQFSESERN FLRKTLGMES PSINPSAKSL QPPPCKRALL PSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-252412110107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150436e-64AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153822.10.0hypothetical protein PHAVU_003G067800g
TrEMBLA0A151UBF30.0A0A151UBF3_CAJCA; Myb-related protein B
STRINGGLYMA02G02310.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-167myb domain protein 88